SCOPe 2.07: Domain d5ks9c1: 5ks9 C:0-81

Lineage for d5ks9c1 (5ks9 C:0-81)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.0: automated matches [227140] (1 protein)
not a true family
Protein automated matches [226842] (5 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)

Domain d5ks9c1: 5ks9 C:0-81 [323152]
Other proteins in same PDB: d5ks9a2, d5ks9b2, d5ks9c2, d5ks9d2, d5ks9e1, d5ks9e2, d5ks9f1, d5ks9f2, d5ks9g1, d5ks9g2, d5ks9h1, d5ks9h2
automated match to d4z7ua1
complexed with ca, nag

Details for d5ks9c1

PDB Entry: 5ks9 (more details), 2.55 Å

PDB Description: bel502-dq8-glia-alpha1 complex

PDB Compounds: (C:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d5ks9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ks9c1 d.19.1.0 (C:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
altniavlkhnlnivikrsnsta

SCOPe Domain Coordinates for d5ks9c1:

Click to download the PDB-style file with coordinates for d5ks9c1.
(The format of our PDB-style files is described here.)

Timeline for d5ks9c1: