Lineage for d5ks9e1 (5ks9 E:9-129)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (29 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) 
Domain d5ks9e1: 5ks9 E:9-129 [323080]
Other proteins in same PDB: d5ks9a1, d5ks9a2, d5ks9b1, d5ks9c1, d5ks9c2, d5ks9d1, d5ks9e2, d5ks9f2, d5ks9g2, d5ks9h2
automated match to d2pyfa1
complexed with ca, nag
Details for d5ks9e1
PDB Entry: 5ks9 (more details), 2.55 Å
PDB Description: bel502-dq8-glia-alpha1 complex
PDB Compounds: (E:) Bel502 TCR alpha TRAV20*01SCOPe Domain Sequences for d5ks9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ks9e1 b.1.1.0 (E:9-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekekerl
katltkkesflhitapkpedsatylcavalnnnagnmltfgggtrlmvkph
SCOPe Domain Coordinates for d5ks9e1:
Click to download the PDB-style file with coordinates for d5ks9e1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ks9e1:
View in 3D
