| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
| Domain d5l2wb1: 5l2w B:88-227 [321842] Other proteins in same PDB: d5l2wa1, d5l2wa2 automated match to d1w98b2 complexed with 1qk, gol |
PDB Entry: 5l2w (more details), 2.8 Å
SCOPe Domain Sequences for d5l2wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l2wb1 a.74.1.1 (B:88-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh
retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs
gdeiltmelmimkalkwrls
Timeline for d5l2wb1: