SCOPe 2.06: Domain d5l2wb1: 5l2w B:88-227

Lineage for d5l2wb1 (5l2w B:88-227)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (10 PDB entries)

8. Domain d5l2wb1: 5l2w B:88-227 [321842]
   Other proteins in same PDB: d5l2wa1, d5l2wa2
   automated match to d1w98b2
   complexed with 1qk, gol

Details for d5l2wb1

PDB Entry: 5l2w, 2.8 Å

PDB Description: the x-ray co-crystal structure of human cdk2/cycline and dinaciclib.

PDB Compounds: (B:) G1/S-specific cyclin-E1

SCOPe Domain Sequences for d5l2wb1:

Sequence; same for both SEQRES and ATOM records:

>d5l2wb1 a.74.1.1 (B:88-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
splpvlswanreevwkimlnkektylrdqhfleqhpllqpkmrailldwlmevcevyklh
retfylaqdffdrymatqenvvktllqligisslfiaakleeiyppklhqfayvtdgacs
gdeiltmelmimkalkwrls

Timeline for d5l2wb1:

• d5l2wb1 is new in SCOPe 2.06-stable
  
• d5l2wb1 appears in SCOPe 2.07
  
• d5l2wb1 appears in the current release, SCOPe 2.08