Lineage for d5l2wb2 (5l2w B:228-357)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718557Protein automated matches [227027] (3 species)
    not a true protein
  7. 2718587Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)
  8. 2718639Domain d5l2wb2: 5l2w B:228-357 [321843]
    Other proteins in same PDB: d5l2wa1, d5l2wa2
    automated match to d1w98b1
    complexed with 1qk, gol

Details for d5l2wb2

PDB Entry: 5l2w (more details), 2.8 Å

PDB Description: the x-ray co-crystal structure of human cdk2/cycline and dinaciclib.
PDB Compounds: (B:) G1/S-specific cyclin-E1

SCOPe Domain Sequences for d5l2wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l2wb2 a.74.1.1 (B:228-357) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pltivswlnvymqvaylndlhevllpqypqqifiqiaelldlcvldvdclefpygilaas
alyhfssselmqkvsgyqwcdiencvkwmvpfamviretgssklkhfrgvadedahniqt
hrdsldlldk

SCOPe Domain Coordinates for d5l2wb2:

Click to download the PDB-style file with coordinates for d5l2wb2.
(The format of our PDB-style files is described here.)

Timeline for d5l2wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5l2wb1