SCOPe 2.01: Domain d1efta3: 1eft A:1-212

Lineage for d1efta3 (1eft A:1-212)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)

8. Domain d1efta3: 1eft A:1-212 [32123]
   Other proteins in same PDB: d1efta1, d1efta2
   complexed with gnp, mg

Details for d1efta3

PDB Entry: 1eft, 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1efta3:

Sequence; same for both SEQRES and ATOM records:

>d1efta3 c.37.1.8 (A:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]}
akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

Timeline for d1efta3:

• d1efta3 first appeared (with stable ids) in SCOP 1.55, called d1eft_3
  
• d1efta3 appears in SCOP 1.75
  
• d1efta3 appears in SCOPe 2.02
  
• d1efta3 appears in the current release, SCOPe 2.08