SCOPe 2.01: Domain d1efta2: 1eft A:313-405

Lineage for d1efta2 (1eft A:313-405)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)

7. Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)

8. Domain d1efta2: 1eft A:313-405 [25728]
   Other proteins in same PDB: d1efta1, d1efta3
   complexed with gnp, mg

Details for d1efta2

PDB Entry: 1eft, 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1efta2:

Sequence; same for both SEQRES and ATOM records:

>d1efta2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

Timeline for d1efta2:

• d1efta2 first appeared (with stable ids) in SCOP 1.55, called d1eft_2
  
• d1efta2 appears in SCOP 1.75
  
• d1efta2 appears in SCOPe 2.02
  
• d1efta2 appears in the current release, SCOPe 2.08