Lineage for d1efta3 (1eft A:1-212)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867148Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2867174Species Thermus aquaticus [TaxId:271] [52628] (4 PDB entries)
  8. 2867175Domain d1efta3: 1eft A:1-212 [32123]
    Other proteins in same PDB: d1efta1, d1efta2
    complexed with gnp, mg

Details for d1efta3

PDB Entry: 1eft (more details), 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1efta3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efta3 c.37.1.8 (A:1-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus aquaticus [TaxId: 271]}
akgefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerarg
itintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehi
llarqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallale
emhknpktkrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d1efta3:

Click to download the PDB-style file with coordinates for d1efta3.
(The format of our PDB-style files is described here.)

Timeline for d1efta3: