Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) |
Family c.37.1.8: G proteins [52592] (20 proteins) |
Protein Transducin (alpha subunit) [52623] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries) |
Domain d1gg2a2: 1gg2 A:5-60,A:182-348 [32109] Other proteins in same PDB: d1gg2a1, d1gg2b_, d1gg2g_ |
PDB Entry: 1gg2 (more details), 2.4 Å
SCOP Domain Sequences for d1gg2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg2a2 c.37.1.8 (A:5-60,A:182-348) Transducin (alpha subunit) {Rat (Rattus norvegicus)} lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi vethftfkdlhfkmfdvgaqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnl
Timeline for d1gg2a2: