SCOPe 2.08: Domain d1gg2a2: 1gg2 A:5-60,A:182-348

Lineage for d1gg2a2 (1gg2 A:5-60,A:182-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
   Uniprot P10824

8. Domain d1gg2a2: 1gg2 A:5-60,A:182-348 [32109]
   Other proteins in same PDB: d1gg2a1, d1gg2b_, d1gg2g_
   complexed with gdp; mutant
   has additional subdomain(s) that are not in the common domain

Details for d1gg2a2

PDB Entry: 1gg2, 2.4 Å

PDB Description: g protein heterotrimer mutant gi_alpha_1(g203a) beta_1 gamma_2 with gdp bound

PDB Compounds: (A:) g protein gi alpha 1

SCOPe Domain Sequences for d1gg2a2:

Sequence; same for both SEQRES and ATOM records:

>d1gg2a2 c.37.1.8 (A:5-60,A:182-348) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgi
vethftfkdlhfkmfdvgaqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmh
esmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiq
cqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnl

Timeline for d1gg2a2:

• d1gg2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1gg2a2 appears in SCOPe 2.07