Lineage for d5jneg_ (5jne G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932423Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)
  8. 2932429Domain d5jneg_: 5jne G: [321087]
    Other proteins in same PDB: d5jneb1, d5jneb2, d5jned1, d5jned2, d5jnef_, d5jneh1, d5jneh2
    automated match to d1euvb_
    complexed with 6ln, gol, zn

Details for d5jneg_

PDB Entry: 5jne (more details), 2.85 Å

PDB Description: e2-sumo-siz1 e3-sumo-pcna complex
PDB Compounds: (G:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d5jneg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jneg_ d.15.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
thinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedl
dmedndiieahreqigg

SCOPe Domain Coordinates for d5jneg_:

Click to download the PDB-style file with coordinates for d5jneg_.
(The format of our PDB-style files is described here.)

Timeline for d5jneg_: