![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries) |
![]() | Domain d5jneg_: 5jne G: [321087] Other proteins in same PDB: d5jneb1, d5jneb2, d5jned1, d5jned2, d5jnef_, d5jneh1, d5jneh2 automated match to d1euvb_ complexed with 6ln, gol, zn |
PDB Entry: 5jne (more details), 2.85 Å
SCOPe Domain Sequences for d5jneg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jneg_ d.15.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} thinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedl dmedndiieahreqigg
Timeline for d5jneg_: