| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries) |
| Domain d5jneh2: 5jne H:127-256 [321086] Other proteins in same PDB: d5jneb1, d5jneb2, d5jnec_, d5jnef_, d5jneg_ automated match to d1plqa2 complexed with 6ln, gol, zn |
PDB Entry: 5jne (more details), 2.85 Å
SCOPe Domain Sequences for d5jneh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jneh2 d.131.1.2 (H:127-256) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gieelqydstlslpssefskivrdlsqlsdsinimitcetikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfnd
Timeline for d5jneh2: