Lineage for d5jneh2 (5jne H:127-256)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977062Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)
  8. 2977074Domain d5jneh2: 5jne H:127-256 [321086]
    Other proteins in same PDB: d5jneb1, d5jneb2, d5jnec_, d5jnef_, d5jneg_
    automated match to d1plqa2
    complexed with 6ln, gol, zn

Details for d5jneh2

PDB Entry: 5jne (more details), 2.85 Å

PDB Description: e2-sumo-siz1 e3-sumo-pcna complex
PDB Compounds: (H:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5jneh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jneh2 d.131.1.2 (H:127-256) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gieelqydstlslpssefskivrdlsqlsdsinimitcetikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkfnd

SCOPe Domain Coordinates for d5jneh2:

Click to download the PDB-style file with coordinates for d5jneh2.
(The format of our PDB-style files is described here.)

Timeline for d5jneh2: