SCOPe 2.08: Domain d5jned1: 5jne D:1-126

Lineage for d5jned1 (5jne D:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [270905] (11 PDB entries)

8. Domain d5jned1: 5jne D:1-126 [321089]
   Other proteins in same PDB: d5jneb1, d5jneb2, d5jnec_, d5jnef_, d5jneg_
   automated match to d1plqa1
   complexed with 6ln, gol, zn

Details for d5jned1

PDB Entry: 5jne, 2.85 Å

PDB Description: e2-sumo-siz1 e3-sumo-pcna complex

PDB Compounds: (D:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5jned1:

Sequence; same for both SEQRES and ATOM records:

>d5jned1 d.131.1.2 (D:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslsdilregnntdtltliadntpdsiillfedtkkddiaeyslklmd
idadfl

Timeline for d5jned1:

• d5jned1 first appeared in SCOPe 2.06
  
• d5jned1 appears in SCOPe 2.07