| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
| Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries) Uniprot P04896 39-388 |
| Domain d1culc2: 1cul C:39-65,C:202-386 [32087] Other proteins in same PDB: d1cula_, d1culb_, d1culc1 complexed with 103, 3po, cl, fok, gsp, mes, mg |
PDB Entry: 1cul (more details), 2.4 Å
SCOPe Domain Sequences for d1culc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1culc2 c.37.1.8 (C:39-65,C:202-386) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrm
Timeline for d1culc2: