| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries) |
| Domain d1culc1: 1cul C:86-201 [18204] Other proteins in same PDB: d1cula_, d1culb_, d1culc2 complexed with 103, 3po, cl, fok, gsp, mes, mg |
PDB Entry: 1cul (more details), 2.4 Å
SCOPe Domain Sequences for d1culc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1culc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1culc1: