| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
| Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species) |
| Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries) Uniprot P30803 458-646 |
| Domain d1cula_: 1cul A: [39417] Other proteins in same PDB: d1culb_, d1culc1, d1culc2 complexed with 103, 3po, cl, fok, gsp, mes, mg |
PDB Entry: 1cul (more details), 2.4 Å
SCOPe Domain Sequences for d1cula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cula_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil
Timeline for d1cula_: