Lineage for d1tndc2 (1tnd C:27-56,C:178-342)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867892Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2867893Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
    Uniprot P04896 39-388
  8. 2867907Domain d1tndc2: 1tnd C:27-56,C:178-342 [32083]
    Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1
    complexed with cac, gsp, mg
    has additional subdomain(s) that are not in the common domain

Details for d1tndc2

PDB Entry: 1tnd (more details), 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s
PDB Compounds: (C:) transducin

SCOPe Domain Sequences for d1tndc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tndc2 c.37.1.8 (C:27-56,C:178-342) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

SCOPe Domain Coordinates for d1tndc2:

Click to download the PDB-style file with coordinates for d1tndc2.
(The format of our PDB-style files is described here.)

Timeline for d1tndc2: