| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries) |
| Domain d1tndc1: 1tnd C:57-177 [18200] Other proteins in same PDB: d1tnda2, d1tndb2, d1tndc2 complexed with cac, gsp, mg |
PDB Entry: 1tnd (more details), 2.2 Å
SCOPe Domain Sequences for d1tndc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tndc1 a.66.1.1 (C:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t
Timeline for d1tndc1:
View in 3DDomains from other chains: (mouse over for more information) d1tnda1, d1tnda2, d1tndb1, d1tndb2 |