| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins) C-terminal domain is all-alpha |
| Protein automated matches [315351] (2 species) not a true protein |
| Species Methanothermobacter wolfeii [TaxId:145261] [320248] (1 PDB entry) |
| Domain d5a8ke1: 5a8k E:2-188 [320384] Other proteins in same PDB: d5a8ka2, d5a8kb2, d5a8kc_, d5a8kd2, d5a8ke2, d5a8kf_ automated match to d1hbnb2 complexed with ca, com, etx, f43, k, mg, tp7 |
PDB Entry: 5a8k (more details), 1.41 Å
SCOPe Domain Sequences for d5a8ke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a8ke1 d.58.31.2 (E:2-188) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtkvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp
Timeline for d5a8ke1: