Lineage for d5a8kd1 (5a8k D:2-269)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2561940Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2562001Protein automated matches [315351] (2 species)
    not a true protein
  7. 2562011Species Methanothermobacter wolfeii [TaxId:145261] [320248] (1 PDB entry)
  8. 2562014Domain d5a8kd1: 5a8k D:2-269 [320318]
    Other proteins in same PDB: d5a8ka2, d5a8kb2, d5a8kc_, d5a8kd2, d5a8ke2, d5a8kf_
    automated match to d1hbna2
    complexed with ca, com, etx, f43, k, mg, tp7

Details for d5a8kd1

PDB Entry: 5a8k (more details), 1.41 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter wolfeii at 1.4 a resolution
PDB Compounds: (D:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d5a8kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8kd1 d.58.31.2 (D:2-269) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaekrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqlwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d5a8kd1:

Click to download the PDB-style file with coordinates for d5a8kd1.
(The format of our PDB-style files is described here.)

Timeline for d5a8kd1: