SCOPe 2.07: Domain d5jhsn_: 5jhs N:

Lineage for d5jhsn_ (5jhs N:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5jhsn_: 5jhs N: [320361]
   Other proteins in same PDB: d5jhsa_, d5jhsc_, d5jhsd_, d5jhse_, d5jhsg_, d5jhsi_, d5jhsj_, d5jhsk_, d5jhsl_, d5jhso_, d5jhsq_, d5jhsr_, d5jhss_, d5jhsu_, d5jhsw_, d5jhsx_, d5jhsy_, d5jhsz_
   automated match to d3wxrv_
   complexed with 6kg, cl, mes, mg

Details for d5jhsn_

PDB Entry: 5jhs, 3 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 15

PDB Compounds: (N:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d5jhsn_:

Sequence; same for both SEQRES and ATOM records:

>d5jhsn_ d.153.1.4 (N:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

Timeline for d5jhsn_:

• d5jhsn_ first appeared in SCOPe 2.06
  
• d5jhsn_ appears in the current release, SCOPe 2.08