Lineage for d5jhsr_ (5jhs R:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602540Domain d5jhsr_: 5jhs R: [320377]
    Other proteins in same PDB: d5jhsa_, d5jhsb_, d5jhsf_, d5jhsh_, d5jhsi_, d5jhsj_, d5jhsk_, d5jhsm_, d5jhsn_, d5jhso_, d5jhsp_, d5jhst_, d5jhsv_, d5jhsw_, d5jhsx_, d5jhsy_
    automated match to d1iruf_
    complexed with 6kg, cl, mes, mg

Details for d5jhsr_

PDB Entry: 5jhs (more details), 3 Å

PDB Description: yeast 20s proteasome in complex with the peptidic epoxyketone inhibitor 15
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5jhsr_:

Sequence, based on SEQRES records: (download)

>d5jhsr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d5jhsr_ d.153.1.0 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d5jhsr_:

Click to download the PDB-style file with coordinates for d5jhsr_.
(The format of our PDB-style files is described here.)

Timeline for d5jhsr_: