Lineage for d3wxrv_ (3wxr V:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600556Domain d3wxrv_: 3wxr V: [262496]
    Other proteins in same PDB: d3wxrb_, d3wxrf_, d3wxrg2, d3wxrj_, d3wxrp_, d3wxrt_, d3wxru2, d3wxrx_
    automated match to d1ryph_
    mutant

Details for d3wxrv_

PDB Entry: 3wxr (more details), 3.15 Å

PDB Description: Yeast 20S proteasome with a mutation of alpha7 subunit
PDB Compounds: (V:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d3wxrv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxrv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
slgtsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiad
ivqyhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplgg
svhklpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvv
ltaagverlifypdeyeql

SCOPe Domain Coordinates for d3wxrv_:

Click to download the PDB-style file with coordinates for d3wxrv_.
(The format of our PDB-style files is described here.)

Timeline for d3wxrv_: