SCOPe 2.08: Domain d5icsf_: 5ics F:

Lineage for d5icsf_ (5ics F:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Retinal dehydrogenase/reductase 3 [141907] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141908] (15 PDB entries)
   Uniprot Q9BPX1 4-253

8. Domain d5icsf_: 5ics F: [319604]
   Other proteins in same PDB: d5icsc2
   automated match to d1ydef_

Details for d5icsf_

PDB Entry: 5ics, 1.52 Å

PDB Description: crystal structure of 17beta-hydroxysteroid dehydrogenase type 14 apoenzyme.

PDB Compounds: (F:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d5icsf_:

Sequence, based on SEQRES records:

>d5icsf_ c.2.1.2 (F:) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgygckasrstp

Sequence, based on observed residues (ATOM records):

>d5icsf_ c.2.1.2 (F:) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgykasrstp

Timeline for d5icsf_:

• d5icsf_ first appeared in SCOPe 2.06
  
• d5icsf_ appears in SCOPe 2.07