PDB entry 5ics

View 5ics on RCSB PDB site
Description: Crystal structure of 17beta-hydroxysteroid dehydrogenase type 14 apoenzyme.
Class: oxidoreductase
Keywords: apoenzyme, hydroxysteroid dehydrogenase, oxidoreductase
Deposited on 2016-02-23, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1
      • conflict (206)
    Domains in SCOPe 2.07: d5icsa_
  • Chain 'C':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1 (Start-271)
      • conflict (206)
      • expression tag (272)
    Domains in SCOPe 2.07: d5icsc1, d5icsc2
  • Chain 'D':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1 (Start-271)
      • conflict (206)
    Domains in SCOPe 2.07: d5icsd1
  • Chain 'F':
    Compound: 17-beta-hydroxysteroid dehydrogenase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD17B14, DHRS10, SDR3, SDR47C1, UNQ502/PRO474
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BPX1
      • conflict (206)
    Domains in SCOPe 2.07: d5icsf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5icsA (A:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5icsA (A:)
    atgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilc
    dvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytl
    tklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvnc
    ispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgi
    ellvtggaelgygasrstp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5icsC (C:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5icsC (C:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckasrpsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5icsD (D:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5icsD (D:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckasrps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5icsF (F:)
    ghmatgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavf
    ilcdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgt
    ytltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvr
    vncispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfc
    tgiellvtggaelgygckasrstpvdapdipsgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5icsF (F:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgykasrstp