![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (65 PDB entries) |
![]() | Domain d5bmva2: 5bmv A:246-439 [319581] Other proteins in same PDB: d5bmva1, d5bmvb1, d5bmvb2, d5bmvc1, d5bmvd1, d5bmvd2, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3 automated match to d4i50a2 complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb |
PDB Entry: 5bmv (more details), 2.5 Å
SCOPe Domain Sequences for d5bmva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bmva2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d5bmva2: