![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
![]() | Domain d5bmvf2: 5bmv F:77-378 [319517] Other proteins in same PDB: d5bmva1, d5bmva2, d5bmvb1, d5bmvb2, d5bmvc1, d5bmvc2, d5bmvd1, d5bmvd2, d5bmve_, d5bmvf1, d5bmvf3 automated match to d3tiia2 complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb |
PDB Entry: 5bmv (more details), 2.5 Å
SCOPe Domain Sequences for d5bmvf2:
Sequence, based on SEQRES records: (download)
>d5bmvf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5bmvf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptntderevflaaynrrregregnvwiakgiliss easelldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrts sepynsanfqdktchltnhciqkeynygryeegnemffeefnqylmdalnttlensillq ikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyael cqgivdvaissvfpladtsifikl
Timeline for d5bmvf2: