Lineage for d5bmva1 (5bmv A:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445289Species Cow (Bos taurus) [TaxId:9913] [226564] (50 PDB entries)
  8. 2445435Domain d5bmva1: 5bmv A:1-245 [319580]
    Other proteins in same PDB: d5bmva2, d5bmvb1, d5bmvb2, d5bmvc2, d5bmvd1, d5bmvd2, d5bmve_, d5bmvf1, d5bmvf2, d5bmvf3
    automated match to d4ihja1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, vlb

Details for d5bmva1

PDB Entry: 5bmv (more details), 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-vinblastine complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5bmva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bmva1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5bmva1:

Click to download the PDB-style file with coordinates for d5bmva1.
(The format of our PDB-style files is described here.)

Timeline for d5bmva1: