Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Adenylate kinase [52554] (13 species) |
Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries) contains a zinc-finger subdomain, residues 126-160 |
Domain d1zin_1: 1zin 1-125,161-217 [31915] Other proteins in same PDB: d1zin_2 complexed with ap5, zn |
PDB Entry: 1zin (more details), 1.6 Å
SCOP Domain Sequences for d1zin_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zin_1 c.37.1.1 (1-125,161-217) Adenylate kinase {Bacillus stearothermophilus} mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg lar
Timeline for d1zin_1: