SCOP 1.67: Domain d1zin_1: 1zin 1-125,161-217

Lineage for d1zin_1 (1zin 1-125,161-217)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Adenylate kinase [52554] (13 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries)
   contains a zinc-finger subdomain, residues 126-160

8. Domain d1zin_1: 1zin 1-125,161-217 [31915]
   Other proteins in same PDB: d1zin_2
   complexed with ap5, zn

Details for d1zin_1

PDB Entry: 1zin, 1.6 Å

PDB Description: adenylate kinase with bound ap5a

SCOP Domain Sequences for d1zin_1:

Sequence; same for both SEQRES and ATOM records:

>d1zin_1 c.37.1.1 (1-125,161-217) Adenylate kinase {Bacillus stearothermophilus}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar

Timeline for d1zin_1:

• d1zin_1 first appeared (with stable ids) in SCOP 1.55
  
• d1zin_1 appears in SCOP 1.65
  
• d1zin_1 appears in SCOP 1.69
  
• d1zin_1 appears in the current release, SCOPe 2.08, called d1zina1