Lineage for d1zin_1 (1zin 1-125,161-217)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 483671Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (17 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 483672Protein Adenylate kinase [52554] (13 species)
  7. 483690Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries)
    contains a zinc-finger subdomain, residues 126-160
  8. 483691Domain d1zin_1: 1zin 1-125,161-217 [31915]
    Other proteins in same PDB: d1zin_2

Details for d1zin_1

PDB Entry: 1zin (more details), 1.6 Å

PDB Description: adenylate kinase with bound ap5a

SCOP Domain Sequences for d1zin_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zin_1 c.37.1.1 (1-125,161-217) Adenylate kinase {Bacillus stearothermophilus}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar

SCOP Domain Coordinates for d1zin_1:

Click to download the PDB-style file with coordinates for d1zin_1.
(The format of our PDB-style files is described here.)

Timeline for d1zin_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zin_2