Lineage for d1zin_2 (1zin 126-160)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430170Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 430171Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 430172Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species)
  7. 430175Species Bacillus stearothermophilus [TaxId:1422] [57777] (3 PDB entries)
  8. 430176Domain d1zin_2: 1zin 126-160 [45178]
    Other proteins in same PDB: d1zin_1
    complexed with ap5, zn

Details for d1zin_2

PDB Entry: 1zin (more details), 1.6 Å

PDB Description: adenylate kinase with bound ap5a

SCOP Domain Sequences for d1zin_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zin_2 g.41.2.1 (126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus}
grricrncgatyhlifhppakpgvcdkcggelyqr

SCOP Domain Coordinates for d1zin_2:

Click to download the PDB-style file with coordinates for d1zin_2.
(The format of our PDB-style files is described here.)

Timeline for d1zin_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zin_1