Lineage for d1zin_1 (1zin 1-125,161-217)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 proteins) Protein Adenylate kinase [52554] (8 species) Species Bacillus stearothermophilus [TaxId:1422] [52562] (3 PDB entries) 
Domain d1zin_1: 1zin 1-125,161-217 [31915]
Other proteins in same PDB: d1zin_2
Details for d1zin_1
PDB Entry: 1zin (more details), 1.6 Å
PDB Description: adenylate kinase with bound ap5a
SCOP Domain Sequences for d1zin_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zin_1 c.37.1.1 (1-125,161-217) Adenylate kinase {Bacillus stearothermophilus}
mnlvlmglpgagkgtqaekivaaygiphistgdmfraamkegtplglqakqymdrgdlvp
devtigivrerlskddcqngflldgfprtvaqaealetmladigrkldyvihidvrqdvl
merltXaddneatvanrlevnmkqmkplvdfyeqkgylrningeqdmekvfadirellgg
lar
SCOP Domain Coordinates for d1zin_1:
Click to download the PDB-style file with coordinates for d1zin_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zin_1:
- d1zin_1 appears in SCOP 1.57
- d1zin_1 appears in the current release, SCOPe 2.08, called d1zina1
View in 3D
