Class a: All alpha proteins [46456] (289 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) |
Family a.24.13.0: automated matches [229049] (1 protein) not a true family |
Protein automated matches [229050] (4 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [318283] (1 PDB entry) |
Domain d5l3sg1: 5l3s G:16-87 [318306] Other proteins in same PDB: d5l3sa2, d5l3sc2, d5l3se2, d5l3sg2 automated match to d1qzxa1 complexed with g, gnp, gol, mg, so4 |
PDB Entry: 5l3s (more details), 1.9 Å
SCOPe Domain Sequences for d5l3sg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l3sg1 a.24.13.0 (G:16-87) automated matches {Sulfolobus solfataricus [TaxId: 273057]} stpyekavdefikdlqkslissdvnvklvfsltakikerlnkekppsvlerkewfisivy delsklfggdke
Timeline for d5l3sg1: