SCOPe 2.08: Domain d5l3sg1: 5l3s G:16-87

Lineage for d5l3sg1 (5l3s G:16-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [318283] (1 PDB entry)

8. Domain d5l3sg1: 5l3s G:16-87 [318306]
   Other proteins in same PDB: d5l3sa2, d5l3sc2, d5l3se2, d5l3sg2
   automated match to d1qzxa1
   complexed with g, gnp, gol, mg, so4

Details for d5l3sg1

PDB Entry: 5l3s, 1.9 Å

PDB Description: structure of the gtpase heterodimer of crenarchaeal srp54 and ftsy

PDB Compounds: (G:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d5l3sg1:

Sequence; same for both SEQRES and ATOM records:

>d5l3sg1 a.24.13.0 (G:16-87) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
stpyekavdefikdlqkslissdvnvklvfsltakikerlnkekppsvlerkewfisivy
delsklfggdke

Timeline for d5l3sg1:

• d5l3sg1 first appeared in SCOPe 2.06
  
• d5l3sg1 appears in SCOPe 2.07