Lineage for d5l3sg2 (5l3s G:88-292)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2126015Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2126307Protein automated matches [190304] (11 species)
    not a true protein
  7. 2126348Species Sulfolobus solfataricus [TaxId:273057] [318285] (1 PDB entry)
  8. 2126352Domain d5l3sg2: 5l3s G:88-292 [318307]
    Other proteins in same PDB: d5l3sa1, d5l3sc1, d5l3se1, d5l3sg1
    automated match to d1qzxa3
    complexed with g, gnp, gol, mg, so4

Details for d5l3sg2

PDB Entry: 5l3s (more details), 1.9 Å

PDB Description: structure of the gtpase heterodimer of crenarchaeal srp54 and ftsy
PDB Compounds: (G:) Signal recognition particle 54 kDa protein

SCOPe Domain Sequences for d5l3sg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l3sg2 c.37.1.10 (G:88-292) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
pnvnptklpfiimlvgvqgsgktttagklayfykkrgykvglvaadvyrpaaydqllqlg
nqigvqvygepnnqnpieiakkgvdifvknkmdiiivdtagrhgygeetklleemkemyd
vlkpddvilvidasigqkaydlasrfhqaspigsviitkmdgtakgggalsavvatgati
kfigtgekideletfnakrfvsril

SCOPe Domain Coordinates for d5l3sg2:

Click to download the PDB-style file with coordinates for d5l3sg2.
(The format of our PDB-style files is described here.)

Timeline for d5l3sg2: