SCOPe 2.06: Domain d5jqgc2: 5jqg C:246-440

Lineage for d5jqgc2 (5jqg C:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (9 PDB entries)

8. Domain d5jqgc2: 5jqg C:246-440 [317557]
   Other proteins in same PDB: d5jqga1, d5jqgb1, d5jqgb2, d5jqgc1, d5jqgd1, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2
   automated match to d4i50a2
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqgc2

PDB Entry: 5jqg, 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5jqgc2:

Sequence; same for both SEQRES and ATOM records:

>d5jqgc2 d.79.2.1 (C:246-440) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5jqgc2:

• d5jqgc2 is new in SCOPe 2.06-stable
  
• d5jqgc2 appears in SCOPe 2.07
  
• d5jqgc2 appears in the current release, SCOPe 2.08