SCOPe 2.06: Domain d5jqgd1: 5jqg D:2-243

Lineage for d5jqgd1 (5jqg D:2-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Tubulin beta-subunit [52496] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [63990] (11 PDB entries)
   Uniprot P02550 ! Uniprot P02554

8. Domain d5jqgd1: 5jqg D:2-243 [317583]
   Other proteins in same PDB: d5jqga1, d5jqga2, d5jqgb2, d5jqgc1, d5jqgc2, d5jqgd2, d5jqge_, d5jqgf1, d5jqgf2
   automated match to d1sa0b1
   complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d5jqgd1

PDB Entry: 5jqg, 2.24 Å

PDB Description: an apo tubulin-rb-ttl complex structure used for side-by-side comparison

PDB Compounds: (D:) Tubulin beta chain

SCOPe Domain Sequences for d5jqgd1:

Sequence; same for both SEQRES and ATOM records:

>d5jqgd1 c.32.1.1 (D:2-243) Tubulin beta-subunit {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5jqgd1:

• d5jqgd1 is new in SCOPe 2.06-stable
  
• d5jqgd1 appears in SCOPe 2.07
  
• d5jqgd1 appears in the current release, SCOPe 2.08