SCOPe 2.06: Domain d4i50a2: 4i50 A:246-438

Lineage for d4i50a2 (4i50 A:246-438)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (5 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)

Domain d4i50a2: 4i50 A:246-438 [222915]
Other proteins in same PDB: d4i50a1, d4i50b1, d4i50c1, d4i50d1, d4i50e_, d4i50f1, d4i50f2
automated match to d1z2ba2
complexed with acp, ca, cl, ep, gdp, gol, gtp, mes, mg

Details for d4i50a2

PDB Entry: 4i50 (more details), 2.3 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-epothilone a complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4i50a2:

Sequence, based on SEQRES records: (download)

>d4i50a2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

Sequence, based on observed residues (ATOM records): (download)

>d4i50a2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekheqlsvaeitnacfepanqmvkcdp
rhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpggd
lakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedmaa
lekdyeevgvd

SCOPe Domain Coordinates for d4i50a2:

Click to download the PDB-style file with coordinates for d4i50a2.
(The format of our PDB-style files is described here.)

Timeline for d4i50a2: