SCOPe 2.08: Domain d1djlb_: 1djl B:

Lineage for d1djlb_ (1djl B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
   automatically mapped to Pfam PF02233

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52486] (3 PDB entries)

8. Domain d1djlb_: 1djl B: [31747]
   complexed with gol, nap, so4

Details for d1djlb_

PDB Entry: 1djl, 2 Å

PDB Description: the crystal structure of human transhydrogenase domain iii with bound nadp

PDB Compounds: (B:) transhydrogenase diii

SCOPe Domain Sequences for d1djlb_:

Sequence; same for both SEQRES and ATOM records:

>d1djlb_ c.31.1.4 (B:) Transhydrogenase domain III (dIII) {Human (Homo sapiens) [TaxId: 9606]}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es

Timeline for d1djlb_:

• d1djlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1djlb_ appears in SCOPe 2.07