Lineage for d1djla_ (1djl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862854Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 2862855Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 2862858Species Human (Homo sapiens) [TaxId:9606] [52486] (3 PDB entries)
  8. 2862859Domain d1djla_: 1djl A: [31746]
    complexed with gol, nap, so4

Details for d1djla_

PDB Entry: 1djl (more details), 2 Å

PDB Description: the crystal structure of human transhydrogenase domain iii with bound nadp
PDB Compounds: (A:) transhydrogenase diii

SCOPe Domain Sequences for d1djla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djla_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Human (Homo sapiens) [TaxId: 9606]}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es

SCOPe Domain Coordinates for d1djla_:

Click to download the PDB-style file with coordinates for d1djla_.
(The format of our PDB-style files is described here.)

Timeline for d1djla_: