PDB entry 1djl

View 1djl on RCSB PDB site
Description: the crystal structure of human transhydrogenase domain III with bound nadp
Class: oxidoreductase
Keywords: rossmann fold dinucleotide binding fold reverse binding of nadp, oxidoreductase
Deposited on 1999-12-03, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transhydrogenase diii
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djla_
  • Chain 'B':
    Compound: transhydrogenase diii
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1djlb_
  • Heterogens: SO4, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1djlA (A:)
    mnrslanvilggygttstaggkpmeisgthteinldnaidmireansiiitpgyglcaak
    aqypiadlvkmlteqgkkvrfgihpvagrmpgqlnvllaeagvpydivlemdeinhdfpd
    tdlvlvigandtvnsaaqedpnsiiagmpvlevwkskqvivmkrslgvgyaavdnpifyk
    pntamllgdakktcdalqakvresyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djlA (A:)
    pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
    ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
    siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
    es
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1djlB (B:)
    mnrslanvilggygttstaggkpmeisgthteinldnaidmireansiiitpgyglcaak
    aqypiadlvkmlteqgkkvrfgihpvagrmpgqlnvllaeagvpydivlemdeinhdfpd
    tdlvlvigandtvnsaaqedpnsiiagmpvlevwkskqvivmkrslgvgyaavdnpifyk
    pntamllgdakktcdalqakvresyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1djlB (B:)
    pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
    ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
    siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
    es