Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [224919] (34 PDB entries) |
Domain d5ferf_: 5fer F: [317466] Other proteins in same PDB: d5ferb_, d5fere_ automated match to d1ogwa_ complexed with zn |
PDB Entry: 5fer (more details), 2.34 Å
SCOPe Domain Sequences for d5ferf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ferf_ d.15.1.1 (F:) Ubiquitin {Cow (Bos taurus) [TaxId: 9913]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d5ferf_: