SCOPe 2.06: Domain d5fere_: 5fer E:

Lineage for d5fere_ (5fer E:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d5fere_: 5fer E: [317482]
   Other proteins in same PDB: d5ferc_, d5ferf_
   automated match to d2c4pa_
   complexed with zn

Details for d5fere_

PDB Entry: 5fer, 2.34 Å

PDB Description: complex of trim25 ring with ubch5-ub

PDB Compounds: (E:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d5fere_:

Sequence; same for both SEQRES and ATOM records:

>d5fere_ d.20.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkriqkelsdlqrdppahcragpvgddlfhwqatimgppdsayqggvffltvhfptdy
pfkppkiafttkiyhpninsngsikldilrsqwspaltvskvllsicsllcdpnpddplv
pdiaqiyksdkekynrharewtqkya

Timeline for d5fere_:

• d5fere_ is new in SCOPe 2.06-stable
  
• d5fere_ appears in SCOPe 2.07
  
• d5fere_ appears in the current release, SCOPe 2.08