| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
| Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
| Species Paracoccus denitrificans [TaxId:266] [52474] (1 PDB entry) |
| Domain d1efpc2: 1efp C:185-308 [31730] Other proteins in same PDB: d1efpa1, d1efpb_, d1efpc1, d1efpd_ complexed with amp, fad |
PDB Entry: 1efp (more details), 2.6 Å
SCOPe Domain Sequences for d1efpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efpc2 c.31.1.2 (C:185-308) C-terminal domain of the electron transfer flavoprotein alpha subunit {Paracoccus denitrificans [TaxId: 266]}
sdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqvgqt
gkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvvpel
tgkl
Timeline for d1efpc2:
View in 3DDomains from other chains: (mouse over for more information) d1efpa1, d1efpa2, d1efpb_, d1efpd_ |