| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species) contains an additional FAD-binding domain of DHS-like fold |
| Species Paracoccus denitrificans [TaxId:266] [81391] (1 PDB entry) |
| Domain d1efpa1: 1efp A:2-184 [31635] Other proteins in same PDB: d1efpa2, d1efpb_, d1efpc2, d1efpd_ complexed with amp, fad |
PDB Entry: 1efp (more details), 2.6 Å
SCOPe Domain Sequences for d1efpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efpa1 c.26.2.3 (A:2-184) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}
avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
vae
Timeline for d1efpa1:
View in 3DDomains from other chains: (mouse over for more information) d1efpb_, d1efpc1, d1efpc2, d1efpd_ |