| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species) binds AMP |
| Species Paracoccus denitrificans [TaxId:266] [81392] (1 PDB entry) |
| Domain d1efpb_: 1efp B: [31636] Other proteins in same PDB: d1efpa1, d1efpa2, d1efpc1, d1efpc2 complexed with amp, fad |
PDB Entry: 1efp (more details), 2.6 Å
SCOPe Domain Sequences for d1efpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]}
mkvlvpvkrlidynvkarvksdgsgvdlanvkmsmnpfdeiaveeairlkekgqaeeiia
vsigvkqaaetlrtalamgadrailvvaaddvqqdieplavakilaavaraegteliiag
kqaidndmnatgqmlaailgwaqatfaskveiegakakvtrevdgglqtiavslpavvta
dlrlnepryaslpnimkakkkpldektaadygvdvaprlevvsvrepegrkagikvgsvd
elvgkl
Timeline for d1efpb_: