Lineage for d1efpa1 (1efp A:2-184)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22627Fold c.29: ETFP adenine nucleotide-binding domain-like [52430] (1 superfamily)
  4. 22628Superfamily c.29.1: ETFP adenine nucleotide-binding domain-like [52431] (2 families) (S)
  5. 22629Family c.29.1.1: Electron transfer flavoprotein, ETFP [52432] (1 protein)
  6. 22630Protein Electron transfer flavoprotein, ETFP [52433] (2 species)
  7. 22634Species Paracoccus denitrificans [TaxId:266] [52435] (1 PDB entry)
  8. 22635Domain d1efpa1: 1efp A:2-184 [31635]
    Other proteins in same PDB: d1efpa2, d1efpc2

Details for d1efpa1

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans

SCOP Domain Sequences for d1efpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpa1 c.29.1.1 (A:2-184) Electron transfer flavoprotein, ETFP {Paracoccus denitrificans}
avlllgevtngalnrdatakavaavkalgdvtvlcagasakaaaeeaakiagvakvlvae
dalyghrlaeptaalivglagdyshiaapattdaknvmprvaalldvmvlsdvsaildad
tferpiyagnaiqvvkskdakkvftirtasfdaageggtapvtetaaaadpglsswvade
vae

SCOP Domain Coordinates for d1efpa1:

Click to download the PDB-style file with coordinates for d1efpa1.
(The format of our PDB-style files is described here.)

Timeline for d1efpa1: