Lineage for d1efpc2 (1efp C:185-308)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22757Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 22758Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (4 families) (S)
  5. 22763Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein)
  6. 22764Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (2 species)
  7. 22767Species Paracoccus denitrificans [TaxId:266] [52474] (1 PDB entry)
  8. 22769Domain d1efpc2: 1efp C:185-308 [31730]
    Other proteins in same PDB: d1efpa1, d1efpb1, d1efpc1, d1efpd1

Details for d1efpc2

PDB Entry: 1efp (more details), 2.6 Å

PDB Description: electron transfer flavoprotein (etf) from paracoccus denitrificans

SCOP Domain Sequences for d1efpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efpc2 c.31.1.2 (C:185-308) C-terminal domain of the electron transfer flavoprotein alpha subunit {Paracoccus denitrificans}
sdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqvgqt
gkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvvpel
tgkl

SCOP Domain Coordinates for d1efpc2:

Click to download the PDB-style file with coordinates for d1efpc2.
(The format of our PDB-style files is described here.)

Timeline for d1efpc2: