Lineage for d1dv2a2 (1dv2 A:1-114)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120506Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2120513Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2120516Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)
  8. 2120562Domain d1dv2a2: 1dv2 A:1-114 [31645]
    Other proteins in same PDB: d1dv2a1, d1dv2a3, d1dv2a4, d1dv2b1, d1dv2b3, d1dv2b4
    complexed with atp; mutant

Details for d1dv2a2

PDB Entry: 1dv2 (more details), 2.5 Å

PDB Description: the structure of biotin carboxylase, mutant e288k, complexed with atp
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d1dv2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv2a2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d1dv2a2:

Click to download the PDB-style file with coordinates for d1dv2a2.
(The format of our PDB-style files is described here.)

Timeline for d1dv2a2: