| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
| Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [52443] (24 PDB entries) |
| Domain d1dv2a2: 1dv2 A:1-114 [31645] Other proteins in same PDB: d1dv2a1, d1dv2a3, d1dv2a4, d1dv2b1, d1dv2b3, d1dv2b4 complexed with atp; mutant |
PDB Entry: 1dv2 (more details), 2.5 Å
SCOPe Domain Sequences for d1dv2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv2a2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d1dv2a2:
View in 3DDomains from other chains: (mouse over for more information) d1dv2b1, d1dv2b2, d1dv2b3, d1dv2b4 |